PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G032600.1
Common NamePHAVU_001G032600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 301aa    MW: 33425.2 Da    PI: 7.2212
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G032600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-151462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        rg+W++eEd  l+ +v  +G+g +W + +++ g++R++k+c++rw++yl
  Phvul.001G032600.1 14 RGPWSPEEDAALKTYVDSHGTGgNWIALPKKAGLRRCGKSCRLRWLNYL 62
                        89*********************************************97 PP

2Myb_DNA-binding43.57.5e-1469111246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g +T+eEd ++ ++  q+G++ W++Ia+++  gRt++++k++w++
  Phvul.001G032600.1  69 GGFTEEEDNIICNLYGQMGSR-WSAIASKLH-GRTDNDVKNYWNT 111
                         569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.653962IPR017930Myb domain
SuperFamilySSF466892.97E-2711109IPR009057Homeodomain-like
SMARTSM007174.5E-111364IPR001005SANT/Myb domain
PfamPF002492.7E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-241569IPR009057Homeodomain-like
CDDcd001671.90E-81662No hitNo description
PROSITE profilePS5129421.10863117IPR017930Myb domain
SMARTSM007171.1E-1267115IPR001005SANT/Myb domain
PfamPF002496.2E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2470118IPR009057Homeodomain-like
CDDcd001677.34E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDAALKTYVD SHGTGGNWIA LPKKAGLRRC GKSCRLRWLN  60
YLRPDIKHGG FTEEEDNIIC NLYGQMGSRW SAIASKLHGR TDNDVKNYWN TKLKKKMIAG  120
KVCLKTFTEN GILPSTSTPL PTNQSLNIQN SPFNASPNQT LVPPILEAND NNAFTIDQNS  180
FISFDQTNHH EVMHGGAASS RINKNTNDNN SNSHMVSLSQ EGSSSISDSS SIAMNYNKCV  240
VSQPQQQQQQ QSDESMDKFM DFGFGFPYDF ANGANCHYER VGEVFAPEWV DFSYADIKPH  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150365e-91AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007160971.10.0hypothetical protein PHAVU_001G032600g
SwissprotQ9SJL72e-71RAX2_ARATH; Transcription factor RAX2
TrEMBLV7CUK30.0V7CUK3_PHAVU; Uncharacterized protein
STRINGGLYMA14G10483.11e-136(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.11e-71MYB family protein